• Thanks for featuring us:

  Readers Digest Canada Best of the Web, Book Television, About.com Humor Site of the Day, NBC4.TV Los Angeles, WNBC.Com New York, Chicago Sun-Times, Dallas Morning News, BBC.co.uk, Canadian Learning TV, CBC Radio, SBS National Radio Australia, Go Daddy Radio, Edmonton Journal, The Sun, Zoo Weekly Magazine, Oprah, the Minneapolis Star Tribune, (Okay, just kidding about Oprah), newspapers and radio stations through-out the U.S. and more… 
  
  

• Visitors Currently Online:  98

• Visitors since 2004: 

Funny English Bloopers Sections

• Funny Bloopers from Native Speakers

  Funny headlines, stupid quotes, Bushisms, celeb bloopers, courtroom and doctor chart bloopers, funny test answers and other funny mistakes from native English speakers.

• Funny English from Around the World

  Funny English mistakes and bloopers, signs, labels, menus, movie captions, student bloopers and more.

Other Popular Funny Sections

• Free online flash game arcade
• Best Funny Jokes
• Funny, Dumb and Stupid Pick Up Lines
• Vote for the best Pickup lines and Chat up lines.
• Stupid & Funny Quotes, Questions & Sayings
• Tongue Twisters, Anagrams & Palindromes
• Funny Poems, Limericks & Songs
• Celebrity Central: Funny Celeb Quotes and More
• Funny and Cute Lolcats
• Cute Kitten, Puppy & Baby Animal pictures, photos, and videos
• Funny videos
• Cool Optical Illusions and 3d images
• Hot Celebrity Pics, Pictures and Photos

Contact

• mail (at) InnocentEnglish.com

• • NEW THIS MONTH: A Daily cute kitten, puppy & Baby animal section. Shortcut: CuteCutePics.com NEW: Best Wedding Moment Ever! InnocentEnglish Arcade with 3000 FREE FLASH GAMES
  Cute Pug Puppy Licking clean your computer monitor
  
  
  

Hot Pages

Top Rated Most Viewed


Today
  This
Week This
Month All
Time





• 4.0 Amazing Sidewalk Art Page 2
• 4.0 Best sayings 9: More of the top funny sayings
• 4.0 3D Sidewalk Art of Julian Beever- Page 4
• 4.0 Jack Handey Quotes
• 4.0 Daily Quick Break: December 17, 2007: The Best of Emo Philips
• 4.0 Cute pig and puppy with valentine heart spots
• 4.0 Funny English Mistakes From ESL Students: Funny Mistakes and bloopers in English
• 4.0 Funny Dear Abby Letters: Hilarious letters to Dear Abby
• 4.0 Caption this really cute kitten #2
• 4.0 Quantum of Solace: New Bond Movie Trailer Teaser Released Soon

Next 10 Hot Pages







Enter your search terms

Web InnocentEnglish.com Submit search form

Other Stuff

• American Idol youtube Vidoes
• David Cook American Idol Youtube
• 1000 great riddles
• Talking, Animated Chatbot Bell
• Funny Diplomas and Diploma Template
• Movie Quote Database
• Daily Funny Quick Break and Caption this Pic
• Clean Funny Jokes
• Best Famous Quotes
• My young friend, Azure, writes about his interests in this section.
• Funny Animal Pics
• Amazing Videos
• Clean Kids Jokes and Bloopers
• Popular boy and girl baby names 2007-2008
• 2008 baby names
• Girls names origin and meaning
• Boys names origin and meaning
• Free baby name search database: Search by meaning, origin or gender
• Learning English & ESL
• Tattoo Removal and fading
• Politics
• Video Game Reviews and Electronics Reviews
• Funny Love Poems
• Free Grammar Guide
• Online Degree Guide
• Interesting News
• Infinite Heart: Beautiful Soul quotes and Spiritual quotes by Eastern Masters and Christian Mystics and Saints
• Payday loans versus bank overdraft fees
• Who will Obama pick for Vice President Running mate?

Other Cool Sites

• MyStupidJokes.com: My teenage nephew's joke site
• Funny and interesting science essays
• The Infinite Heart: The teachings of 150 masters mystics poets and saints
• SoulBloom.com: Songs from the heart

This free baby name search database lets you type in a name, a meaning, and/or an origin, and it will give you all matches. You can also select gender/sex. When you are typing in a meaning, try to start with one keyword that best matches the meaning, such as strong, or beautiful. The more words you use in the meaning, the fewer returns you will get.

With this huge, free searchable baby name database, which has tens of thousands of unique boys names and girls names, you can find just the right name for your baby boy or baby girl. Give it a try.

,

Name	Gender	Meaning	Origin
	Either M F		Any africanangloarabianarabicaramaicarmenianarthurianbasquecelticchamoruchineseczechoslovakiandanishdutchegyptianenglishfinnishfrenchgaelicgermangreekhawaiianhebrewhindihungarianindianirishitalianjapaneselatinnahuatlnativenorsepersianpolishportugueseromanianrussianscandinavianscottishslavicspanishswedishswissteutonicturkishukrainianvietnamesewelshyiddish Arabic American Indian Hebrew African Unknown Native American French Irish Italian Spanish Anglo-Saxon Arthurian Legend English German Scottish Celtic Russian Greek Hawaiian Latin Basque Japanese Hindu Muslim Sanskrit Romana "Hindi,Greek,Latin" China "Dutch,Swedish,Finnish" Welsh "African,Jamaican,Ameri Maori Gaelic Scandinavian Humaira Persian Japenese Nigeria African American Aramaic Welch "Celtic,Gaelic" Canadian Itailan Slavic Portuguese "English,Greek,Gaelic" Engish Egyptian Aztec Dominican Republic UK Australian Spain Albanian Old English Esm? Etana Eritrea Fhristiansen Del Rosari Norwegian Dominican Irish Gaelic Teutonic Swahili Portugese Africa Sri Lanka Cherokee "Urdu,Indian" Hindi Swahli Scotland Russia Hopi Galic German and Swedish Old French Japan Kira Old Gaelic Australia Cyprus Swedish British African-American "Latin,Greek" Philippines Hawaiin Hungarian Indonesia Ireland "Arabic,Indian,Japanese Bali English. Sweden "Persian,Latin" Netherlands Old Welsh Chinese Royal Bosnian Romania Japanese-Miya Latin-ana Munira French-Slavic Austrailian Bantu English Greek Philipino Middle Eastern Turkish "Ukrainian,Russian" Native Ameracan Xhosa-African Canada Raena Thailand Old German Arabian Kurdish "Hebrew,English" American Samoa Russian-Yugoslavian Grenadian Yiddish Roman Dutch "African,Dutch" "Irish,Celtic" Persian or Iranian Fijian Aboriginal Tayba Lesotho Europe Korean Jewish Ukranian India "Arabic,Hebrew" "African,Arabic" "French,Greek" Romanian Arabic French Hungary East Indian Asian Indian Athan Movie: Neverending Stor Polish Swahilli Bassam "Norway,Scandinavian" "English,Irish" Irish (Gealic) "Latin,African American Wales Jamaican Puerto Rican Nordic Genevyeve Icelandic and Norwegian Ancient Germanic France Yoruba "Arabic,African" Poland Jareth Finnish Scandanavian Katherine "Islamic,Arabic" Jamican Aborigional "Swahilli,Spanish" "French,English" New Zealand Seikh Mexican Biblical "Indian,Hindu" Serbian Turkey Danish Nigerian Bermuda "Yoruba,Nigeria" Mahabharata Holland Zimbabwe Variant of Tariq Vedic Geez

All content is © InnocentEnglish.com: Funny Jokes, Signs, Pics, Bloopers, English mistakes and More, 2004-2008, or is in the public domain, or is © by the respective copyright holders. Please contact for prompt removal of any inadvertent © content, with apologies.